PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014897-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 242aa    MW: 27052.2 Da    PI: 9.506
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014897-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.32e-193984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd++l ++v ++G ++W++I+r+++ gR++k+c++rw + 
    NNU_014897-RA 39 KGPWSTEEDKILTRLVDRYGARNWSLISRYIP-GRSGKSCRLRWCNQ 84
                     79******************************.***********985 PP

2Myb_DNA-binding53.46e-1793135347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
    NNU_014897-RA  93 PFSPAEDETILAAHARYGNR-WATIARILP-GRTDNAVKNHWNST 135
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.4373489IPR017930Myb domain
SuperFamilySSF466892.73E-3137132IPR009057Homeodomain-like
SMARTSM007172.8E-163887IPR001005SANT/Myb domain
PfamPF002493.2E-183984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-254092IPR009057Homeodomain-like
CDDcd001671.01E-144183No hitNo description
SMARTSM007175.6E-1590138IPR001005SANT/Myb domain
PROSITE profilePS5129420.95691140IPR017930Myb domain
PfamPF002494.0E-1493135IPR001005SANT/Myb domain
CDDcd001671.54E-1193136No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2293139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEAFNTCSSS STSSSDSSSS ESSLPGKQVR AISKSERIKG PWSTEEDKIL TRLVDRYGAR  60
NWSLISRYIP GRSGKSCRLR WCNQLSPNVE HRPFSPAEDE TILAAHARYG NRWATIARIL  120
PGRTDNAVKN HWNSTLKRRQ REHRQPVGDN NNKNNGGRNL ELGSPSEMES DPLTTLTLAQ  180
PGVSCSLPER RMESFPAEFW DMMREVIARE VKNYVSSSVA ETVGLPTIEG IQGVSLHSTG  240
RY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-39361391104MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010268711.11e-180PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-56MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0A0LKY36e-90A0A0A0LKY3_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g11170.t015e-88(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-58myb domain protein 77